Snapshot 04 by GeckzGo

Snapshot 04 by

Date: 11/30/2017 Views: 9068 Favorites: 105 Comments: 15


New running shoes ;)


To add a comment, please sign in or create an account.


Love it!! And so does my fiancé


glad you both do =)


That is purrfect shoes


I'd love a 'pair' =)


ill buy a pair


=D same!


where can i get a pair (i dont care if they dont come off)


LivingSkin is stocking them at select retailers nationwide =)


Do they come with a matching suit?


there are cheetah suits, yes =)


cool, i want them x3


same here =)


I want some! Lol


Love to see if the legs match the feet / paws-to-be (not fishing for a sequence :) )

Thank you for sharing


Yo I tried them and they feel great but my hands feel weirnreffjfefjlew ;ilfewfleswarwdqnfkmdasmdaslkdmslkmddwkl;dwkdqwdwqooudwdwqopuiqdwodqwimoc